PNC-27 5mg

Coming Soon

This peptide will be available soon. Join the waitlist to be notified when it launches.

Contact Us

Product description

What is PNC-27 (5mg)?

PNC-27 is a synthetic peptide composed of a segment derived from the p53 tumor suppressor protein, linked to a membrane-penetrating peptide sequence. It has been studied in laboratory research for its interaction with specific cellular membrane components. The peptide is designed to mimic a functional region of the p53 protein, which regulates cell cycle activity and cellular stress responses. Research-grade preparations typically report purity levels ≥98%, verified through analytical techniques. PNC-27 has been studied in experimental models examining peptide-membrane interactions, HDM-2 binding activity, and selective membrane disruption in cancer cell biology research.

What are the key features of PNC-27 (5mg)?

PNC-27 (5mg) is supplied as a research-grade peptide intended for controlled laboratory investigations. The peptide is commonly produced using standardized peptide synthesis techniques and undergoes analytical testing to verify its composition and purity before distribution for research use. Key features of PNC-27 (5mg) include:
  • Peptide length: 32 amino acids derived from a p53-based sequence
  • Subcategory: Research & Oncology Peptides
  • Peptide Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
  • Molecular weight: 4031.7 g/mol
  • Chemical Formula: C₁₈₈H₂₉₃N₅₃O₄₄S
  • Purity: Typically ≥98%, verified by HPLC
  • Analytical confirmation: Validated using mass spectrometry (MS)
  • Format: Lyophilized powder in a 5 mg research vial
This product is supplied strictly for laboratory research use only and is not intended for clinical or therapeutic applications.

How is PNC-27 (5mg) synthesized?

PNC-27 is produced using solid-phase peptide synthesis (SPPS), a widely used method for assembling peptides with precise amino acid sequences. In this process, protected amino acids are sequentially added to a solid resin, ensuring accurate construction of the desired peptide sequence. After synthesis, the peptide undergoes purification using high-performance liquid chromatography (HPLC) to remove incomplete chains or by-products. Mass spectrometry (MS) confirms the peptide's molecular weight and structural integrity. The purified peptide is lyophilized into a powder to minimize degradation and facilitate laboratory handling.

What is PNC-27 (5mg) being studied for? What are its possible benefits?

PNC-27 has been studied in experimental models focusing on peptide-membrane interactions, HDM-2 binding activity, and selective membrane disruption in cancer cell biology research. Researchers have examined how peptides derived from the p53 protein domain interact with specific membrane components present in certain cell types. Research areas involving PNC-27 include membrane pore formation, selective membrane disruption, and cellular signaling responses related to the p53 pathway. Scientists also study how the peptide interacts with HDM-2 proteins on cell membranes. These areas remain under active investigation, and findings are largely limited to preclinical and laboratory research environments.

How does PNC-27 (5mg) work in research studies?

In laboratory studies, PNC-27 is believed to interact with membrane-associated proteins found on certain cells. The peptide contains a segment derived from the p53 protein-binding region, which has been studied for its affinity for HDM-2, a regulatory protein involved in cellular signaling pathways. Researchers have observed that PNC-27 may form transmembrane pores under specific conditions. This process has been studied as part of broader research into peptide-mediated membrane disruption. These observations are limited to controlled experimental models and continue to be examined to better understand the peptide’s biological interactions.

What dosing information exists for PNC-27 (5mg)?

Dosing information for PNC-27 is derived from preclinical studies and laboratory models. In some preclinical models, PNC-27 and structurally related p53-derived peptides have been studied at microgram-level concentrations to assess membrane interaction and cellular responses under controlled conditions. Dosing protocols vary depending on experimental design, species studied, and research objectives. No standardized dosing guidelines exist for human use. Reported experimental concentrations are strictly for research purposes and should not be interpreted as clinical dosage recommendations.

How should PNC-27 (5mg) be stored and handled?

PNC-27 (5mg) is typically supplied as a lyophilized peptide powder to minimize degradation and facilitate laboratory handling. For optimal preservation, the peptide should be stored at –20 °C or lower in a dry, temperature-controlled environment. Exposure to light, moisture, and repeated freeze-thaw cycles should be minimized to preserve structural integrity. After reconstitution with a suitable sterile laboratory solvent, solutions are typically stored at 2–8 °C for short-term use in laboratory experiments. Researchers often prepare small aliquots to reduce degradation caused by repeated thawing and freezing. Proper handling under sterile laboratory conditions helps preserve peptide integrity and reproducibility in experimental work.

Where can I read more research about PNC-27 (5mg)?

  1. Sookraj KA, Bowne WB, Adler V, Sarafraz-Yazdi E, Michl J, Pincus MR. The anti-cancer peptide, PNC-27, induces tumor cell lysis as the intact peptide. Cancer Chemother Pharmacol. 2010;66(2):325-331. doi:10.1007/s00280-009-1166-7
  2. Sarafraz-Yazdi E, Gorelick C, Wagreich AR, et al. Ex vivo Efficacy of Anti-Cancer Drug PNC-27 in the Treatment of Patient-Derived Epithelial Ovarian Cancer. Ann Clin Lab Sci. 2015;45(6):650-658.
  3. Krzesaj P, Adler V, Feinman RD, et al. Anti-Cancer Peptide PNC-27 Kills Cancer Cells by Unique Interactions with Plasma Membrane-Bound hdm-2 and with Mitochondrial Membranes Causing Mitochondrial Disruption. Ann Clin Lab Sci. 2024;54(2):137-148.
  4. Sarafraz-Yazdi E, Bowne WB, Adler V, et al. Anticancer peptide PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding to HDM-2 in their membranes. Proc Natl Acad Sci U S A. 2010;107(5):1918-1923. doi:10.1073/pnas.0909364107

Compliance Statement

This product is intended for laboratory research use only and is not approved for human or veterinary use.

Shop with Confidence: Product Authenticity is Guaranteed

All products available at Doctor Medica shop are obtained from respective manufacturers and contain original LOT numbers Contact us if you have any questions about product LOT numbers.

Products you may also like

ORTHOVISC 2ML ENGLISH 01
$52.00
HYALGAN 1SYRINGE ENGLISH 01
$49.00
RESTYLANE KYSSE with Lidocaine
$189.00
RESTYLANE VOLYME with Lidocaine
$129.00
JUVEDERM VOLUMA LIDOCAINE 2X1ML 01
$359.00